PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G34610.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family WRKY
Protein Properties Length: 442aa    MW: 46501.5 Da    PI: 6.564
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G34610.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY919e-29197253259
                      --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      +DgynWrKYGqK+ k++e prsYY+Ct  gCpvkk vers+ d+ + eitY+g+H h+
  OGLUM03G34610.3 197 KDGYNWRKYGQKQLKDAESPRSYYKCTRDGCPVKKIVERSS-DGCIKEITYKGRHSHP 253
                      8****************************************.***************8 PP

2WRKY103.31.3e-32342400159
                      ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
             WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                      ldDgy+WrKYGqK+vkg++ prsYY+Ct  gC+v+k++er++ dpk+v +tY+g+Hnh+
  OGLUM03G34610.3 342 LDDGYRWRKYGQKVVKGNPRPRSYYKCTADGCNVRKQIERASADPKCVLTTYTGRHNHD 400
                      59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.768191255IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-26192255IPR003657WRKY domain
SuperFamilySSF1182903.4E-23195255IPR003657WRKY domain
SMARTSM007749.8E-31196254IPR003657WRKY domain
PfamPF031064.6E-22197253IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.4E-34327402IPR003657WRKY domain
SuperFamilySSF1182904.84E-28334402IPR003657WRKY domain
PROSITE profilePS5081136.059337402IPR003657WRKY domain
SMARTSM007744.4E-36342401IPR003657WRKY domain
PfamPF031062.5E-24343400IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MADRRRSDGG GGGGGMQQQP FTSPGQERVF DGGGVPGQVA APYGSDFDQS SYMALLAAGA  60
VGVGVGVQPT AAPWAVEEDV AAAPPGISLA PQFSMANYAP PPSYQHPATL VSPPLAAGLH  120
PYPPYLHGVD APPPQWPPRP APPPSFSVLD LAAAAAPHEQ RHSMQQLLLR AAAFGGGMHA  180
AAAPAPAAAA AIEQPAKDGY NWRKYGQKQL KDAESPRSYY KCTRDGCPVK KIVERSSDGC  240
IKEITYKGRH SHPRPVEPRR GGAASSSSST MAAGTDHNAG AAADDAAAAD EDDPSDDDDT  300
LLHEDDDDGE EGHDRGVDGE VGQRVVRKPK IILQTRSEVD LLDDGYRWRK YGQKVVKGNP  360
RPRSYYKCTA DGCNVRKQIE RASADPKCVL TTYTGRHNHD PPGRPPAAAN LQMPGPAAMS  420
LAGGGTAHQQ PSGGAHQMKE ET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-34198402877Probable WRKY transcription factor 4
2lex_A8e-34198402877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418480.0AY341848.1 Oryza sativa (japonica cultivar-group) WRKY7 mRNA, complete cds.
GenBankAY3418520.0AY341852.1 Oryza sativa (japonica cultivar-group) WRKY11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630965.10.0PREDICTED: probable WRKY transcription factor 58
TrEMBLA0A0D9ZDG00.0A0A0D9ZDG0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013598-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g55164.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.18e-37WRKY DNA-binding protein 4